• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TOR1AIP2 Polyclonal Antibody Online Inquiry

Cat#:FPA-42438P
Product Name:Rabbit Anti-TOR1AIP2 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Recombinant fragment corresponding to Human TOR1AIP2 aa 3-63 (N terminal). Sequence: SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPEC YPDNPANRSLV
Species Reactivity: Human Predicted to work with: Mouse, Rat
Isotype: IgG
Application: IHC-P
Storage Buffer: pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS
Storage Procedures: Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

Online Inquiry

refresh