Cat#: | FPA-42438P |
Product Name: | Rabbit Anti-TOR1AIP2 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human TOR1AIP2 aa 3-63 (N terminal). Sequence: SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPEC YPDNPANRSLV |
Species Reactivity: | Human Predicted to work with: Mouse, Rat |
Isotype: | IgG |
Application: | IHC-P |
Storage Buffer: | pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS |
Storage Procedures: | Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. |