Cat#:FPA-42084P;Product Name:Rabbit Anti-TMEM158 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TMEM158 aa 200-250 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: LDFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIA G ;Species Reactivity:Rat Predicted to work with: Mouse, Cow, Human;Isotype:IgG;Application:IHC-P;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;