• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Rat Proteins >

Recombinant Rat Leptin Protein Online Inquiry

Cat#:RP-200RL
Product Name:Recombinant Rat Leptin Protein
Synonym: Lep,leptin, OB, obese, obesity factor
Description: Rat Recombinant Leptin protein expressed in E.coli is a single, non-glycosylated, polypeptide chain containing 147aa and having a molecular weight of 16.3 kDa. The Leptin is purified by proprietary chromatographic techniques.
Source: E.coli
AA Sequence: MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLA VYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLY STEVVALSRLQGSLQDILQQLDLSPEC
Molecular Characterization: 16.3 kDa
Purity: Greater than 95% as analyzed by SDS-PAGE and HPLC.
Endotoxin: < 0.2 EU/μg of rat leptin protein as determined by LAL method.
Bioactivity: ED50 < 10 µg/mL, measured by a cell proliferation assay using LoVo cells, corresponding to a specific activity of > 100 units/mg.
Formulation: Recombinant rat leptin protein was lyophilized after extensive dialysis against 50 mM Tris, pH8.0.
Stability: Recombinant rat leptin proteins are stable for up to 1 year from date of receipt at -70℃
Host Species: Rat
Usage: For Lab Research Use Only
Storage: Store the lyophilized recombinant rat Leptin at -20°C from date of receipt. Upon reconstitution, rat Leptin protein remains stable up to 2 weeks at 4°C or up to 3 months at -20°C. Please avoid freeze-thaw cycles.
References: Differential physiological responses to central leptin overexpression in male and female rats. Côté I, et al. J Neuroendocrinol, 2017 Dec. PMID 29044801
  • Pre product:Recombinant Rat Tyrosine-protein phosphatase non-receptor type substrat e 1 Protein-Advanced Biomart
  • Online Inquiry

    refresh