Cat#:RP-6411H;Product Name:Recombinant Human VEGF (121 a.a.) Protein, Sf9;Synonym:Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.;Description:Vascular Endothelial Growth Factor-121 Protein produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa. VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates. The VEGF-121 is purified by proprietary chromatographic techniques.;Source:Sf9, Insect Cells.;AA Sequence:APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.;Purity:Greater than 95.0% as determined by SDS-PAGE.;Bioactivity:Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.;Formulation:The protein was lyophilized from a solution containing 50mM acetic acid.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50µg/ml.;Storage:Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;