Cat#:RPH-NP297;Product Name:Recombinant Human Omentin / Intelectin-1 / ITLN-1 Protein;Synonym:Intelectin-1, ITLN-1, Endothelial lectin HL-1, Galactofuranose-binding lectin, Intestinal lactoferrin receptor, Omentin, INTL, ITLN, LFR;Description:Recombinant Human Intelectin-1 Protein is produced in E.coli and the target gene encoding Thr19-Ser298 is expressed with a His tag at the N-terminus.;Source:E. coli;AA Sequence:MNHKVHHHHHHMTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCD MTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKN PGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWT DNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCI GGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Omentin/Intelectin-1/ITLN-1 Protein was lyophilized from a 0.2 μm filtered solution of 50mM Tris,100mMNaCl, 5mM GSH, 0.5mM GSSG,pH8.0 .;Stability:Recombinant Human Omentin/Intelectin-1/ITLN-1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human Omentin protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human Omentin protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human Omentin protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;