Cat#:RPH-NP289;Product Name:Recombinant Human Matrix Metalloproteinase-3 / MMP-3 Protein;Synonym:Stromelysin-1, SL-1, Matrix metalloproteinase-3, MMP-3, Transin-1, MMP3, STMY1;Description:Recombinant Human Matrix Metalloproteinase-3 Protein is produced in Human Cells and the target gene encoding Tyr18-Cys477 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:YPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSD TLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPL TFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNL FLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPT EPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDA AYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDK YWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSN SWLNCVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Matrix MetalloProtein ase-3/MMP-3 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.;Stability:Recombinant Human Matrix MetalloProtein ase-3/MMP-3 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store recombinant human MMP3 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Matrix Metalloproteinase-3 Protein is produced in Human Cells and the target gene encoding Tyr18-Cys477 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Matrix MetalloProtein ase-3/MMP-3 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.
Stability:
Recombinant Human Matrix MetalloProtein ase-3/MMP-3 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store recombinant human MMP3 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.