Cat#:RPH-NP268;Product Name:Recombinant Human Lecithin-cholesterol acyltransferase / LCAT Protein;Synonym:Phosphatidylcholine-sterol acyltransferase, also named Lecithin-cholesterol acyltransferase, Phospholipid-cholesterol acyltransferase and LACT, is an extracellular cholesterol esterifying enzyme which belongs to the AB hydrolase superfamily.;Description:Recombinant Human Lecithin-cholesterol acyltransferase Protein is produced in Human Cells and the target gene encoding Phe25-Glu440 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:FWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLN MFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVN NGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQP QAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWP EDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTY IYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHI NAILLGAYRQGPPASPTASPEPPPPEVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Lecithin-cholesterol acyltransferase/LCAT Protein was lyophilized from a 0.2 μm filtered solution of 50mM Acetate Buffer pH-4.0.;Stability:Recombinant Human Lecithin-cholesterol acyltransferase/LCAT Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human LCAT protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LCAT protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human LCAT protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Lecithin-cholesterol acyltransferase / LCAT Protein
Online Inquiry
Cat#:
RPH-NP268
Product Name:
Recombinant Human Lecithin-cholesterol acyltransferase / LCAT Protein
Synonym:
Phosphatidylcholine-sterol acyltransferase, also named Lecithin-cholesterol acyltransferase, Phospholipid-cholesterol acyltransferase and LACT, is an extracellular cholesterol esterifying enzyme which belongs to the AB hydrolase superfamily.
Description:
Recombinant Human Lecithin-cholesterol acyltransferase Protein is produced in Human Cells and the target gene encoding Phe25-Glu440 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Lecithin-cholesterol acyltransferase/LCAT Protein was lyophilized from a 0.2 μm filtered solution of 50mM Acetate Buffer pH-4.0.
Stability:
Recombinant Human Lecithin-cholesterol acyltransferase/LCAT Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human LCAT protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LCAT protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human LCAT protein samples are stable below -20°C for 3 months.