Cat#:RPH-NP245;Product Name:Recombinant Human Interleukin-37 / IL37 Protein;Synonym:Interleukin-37, FIL1 Zeta, IL-1X, Interleukin-1 Family Member 7, IL-1F7, Interleukin-1 Homolog 4, IL-1H, IL-1H4, Interleukin-1 Zeta, IL-1 Zeta, Interleukin-1-Related Protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1;Description:Recombinant Human Interleukin-37 Protein is produced in E.coli and the target gene encoding Lys53-Asp218 is expressed.;Source:E.coli;AA Sequence:MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKG EFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSC NCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-37/IL37 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, pH 7.4.;Stability:Recombinant Human Interleukin-37/IL37 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL37 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL37 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL37 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Interleukin-37/IL37 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, pH 7.4.
Stability:
Recombinant Human Interleukin-37/IL37 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human IL37 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL37 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL37 protein samples are stable below -20°C for 3 months.