Cat#:RPH-NP232;Product Name:Recombinant Human Interleukin-23 / IL23 Protein;Synonym:SGRF,IL-23p19,CLMF p40,IL-12 subunit p40,NKSF2;Description:Recombinant Human Interleukin-23 Protein is produced in Human Cells and the target gene encoding Arg20-Pro189&Ile23-Ser328; is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRD NSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPS LSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPVDHHHHHH&IWELKKDVYVVELDWY; PDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLL LHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGV TCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDII KPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATV ICRKNASISVRAQDRYYSSSWSEWASVPCS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-23/IL23 Protein was lyophilized from a 0.2 μm filtered solution of PBS pH7.4.;Stability:Recombinant Human Interleukin-23/IL23 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL23 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL23 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL23 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;