Cat#:RPH-NP228;Product Name:Recombinant Human Interleukin-21 / IL21 Protein;Synonym:Interleukin-21,IL-21, Za11, IL21;Description:Recombinant Human Interleukin-21 Protein is produced in E.coli and the target gene encoding Gln23-Ser155 is expressed.;Source:E. coli;AA Sequence:MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNE RIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHG SEDS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:Measured by its ability to binding recombinant human IL2RG used funtional ELISA.;Formulation:Recombinant Human Interleukin-21/IL21 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.;Stability:Recombinant Human Interleukin-21/IL21 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL21 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL21 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL21 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
Measured by its ability to binding recombinant human IL2RG used funtional ELISA.
Formulation:
Recombinant Human Interleukin-21/IL21 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Stability:
Recombinant Human Interleukin-21/IL21 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human IL21 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL21 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL21 protein samples are stable below -20°C for 3 months.