Cat#:RPH-NP224;Product Name:Recombinant Human Interleukin-1β / IL1β Protein;Synonym:Interleukin-1 beta, Catabolin, IL1F2, IL1B.;Description:Recombinant Human Interleukin-1 beta Protein is produced in E.coli and the target gene encoding Ala117-Ser269 is expressed.;Source:E. coli;AA Sequence:MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAEN MPVFLGGTKGGQDITDFTMQFVSS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-1β/IL1β Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Interleukin-1β/IL1β Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL1β protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL1β protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL1β protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Interleukin-1β/IL1β Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Interleukin-1β/IL1β Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human IL1β protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL1β protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL1β protein samples are stable below -20°C for 3 months.