Cat#:RPH-NP222;Product Name:Recombinant Human Interleukin-18-Binding Protein / IL18BP ProteinProtein;Synonym:Interleukin-18-binding protein, Tadekinig-alfa and IL18BP,;Description:Recombinant Human IL-18 binding protein Protein is produced in Human Cells and the target gene encoding Thr31-Gly194 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNF SILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQ RHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-18-Binding Protein /IL18BP Protein Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.;Stability:Recombinant Human Interleukin-18-Binding Protein /IL18BP Protein Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL18BP protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL18BP protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL18BP protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;