• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Interleukin-17B / IL17B Protein Online Inquiry

  • Cat#:
  • RPH-NP216
  • Product Name:
  • Recombinant Human Interleukin-17B / IL17B Protein
  • Synonym:
  • cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17B, interleukin-17 beta, interleukin-17B, interleukin 17B, IL20, IL-20, interleukin 20 Interleukin-20; MGC138900; MGC138901; neuronal interleukin-17 related factor; Neuronal interleukin-17-related factor; NIRF; ZCYTO7interleukin-Cytokine Zcyto7; cytokine-like protein ZCYTO7; IL-17Binterleukin-17 beta; IL20; IL-20interleukin-17B; interleukin 17B; interleukin 20; Interleukin-20; MGC138900; MGC138901; neuronal interleukin-17 related factor; Neuronal interleukin-17-related factor; NIRF; ZCYTO7interleukin-
  • Description:
  • Recombinant Human Interleukin-17B Protein is produced in Human Cells and the target gene encoding Gln21-Phe180 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCE VNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVR RRLCPPPPRTGPCRQRAVMETIAVGCTCIFVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Interleukin-17B/IL17B Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Stability:
  • Recombinant Human Interleukin-17B/IL17B Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human IL17B Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL17B protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL17B protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human Interleukin-17A I IL17A Protein I Advanced Biomart
  • Online Inquiry

    refresh