Cat#:RPH-NP209;Product Name:Recombinant Human Interleukin-12 Subunit β / IL12 p40 / IL12B Protein;Synonym:Interleukin-12 subunit beta, IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit, CLMF p40, IL-12 subunit p40, NK cell stimulatory factor chain 2, NKSF2, IL12B, NKSF2;Description:Recombinant Human Interleukin-12 subunit beta Protein is produced in Human Cells and the target gene encoding Ile23-Ser328 is expressed.;Source:Human Cells;AA Sequence:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQ YTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHK LKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSK REKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-12 Subunit β/IL12 p40/IL12B Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Interleukin-12 Subunit β/IL12 p40/IL12B Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL12B Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL12B protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL12B protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Interleukin-12 Subunit β/IL12 p40/IL12B Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Stability:
Recombinant Human Interleukin-12 Subunit β/IL12 p40/IL12B Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human IL12B Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL12B protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL12B protein samples are stable below -20°C for 3 months.