Cat#:RPH-NP203;Product Name:Recombinant Human Interferon γ / IFN-γ Protein;Synonym:Interferon Gamma, IFN-Gamma, Immune Interferon, IFNG;Description:Recombinant Human Interferon gamma Protein is produced in Human Cells and the target gene encoding Gln24-Gln166 is expressed.;Source:Human Cells;AA Sequence:QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQS IQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRK RSQMLFRGRRASQ;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:Specific Activity is greater than 1.5 x 10^7 IU/mg.;Formulation:Recombinant Human Interferon γ/IFN-γ Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.;Stability:Recombinant Human Interferon γ/IFN-γ Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IFN-γ Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IFN-γ protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IFN-γ protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
Specific Activity is greater than 1.5 x 10^7 IU/mg.
Formulation:
Recombinant Human Interferon γ/IFN-γ Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
Stability:
Recombinant Human Interferon γ/IFN-γ Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human IFN-γ Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IFN-γ protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IFN-γ protein samples are stable below -20°C for 3 months.