Cat#:RPH-NP196;Product Name:Recombinant Human Intercellular Adhesion Molecule 1 / ICAM-1 / CD54 Protein;Synonym:Intercellular Adhesion Molecule 1, ICAM-1, Major Group Rhinovirus Receptor, CD54, ICAM1;Description:Recombinant Human Intercellular Adhesion Molecule 1 Protein is produced in Human Cells and the target gene encoding Gln28-Glu480 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMC YSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKEL KREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLV SPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQR LTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGP RAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTP MCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVD HHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Intercellular Adhesion Molecule 1/ICAM-1/CD54 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human Intercellular Adhesion Molecule 1/ICAM-1/CD54 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human ICAM-1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human ICAM-1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human ICAM-1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Intercellular Adhesion Molecule 1 / ICAM-1 / CD54 Protein
Online Inquiry
Cat#:
RPH-NP196
Product Name:
Recombinant Human Intercellular Adhesion Molecule 1 / ICAM-1 / CD54 Protein
Synonym:
Intercellular Adhesion Molecule 1, ICAM-1, Major Group Rhinovirus Receptor, CD54, ICAM1
Description:
Recombinant Human Intercellular Adhesion Molecule 1 Protein is produced in Human Cells and the target gene encoding Gln28-Glu480 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Intercellular Adhesion Molecule 1/ICAM-1/CD54 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Stability:
Recombinant Human Intercellular Adhesion Molecule 1/ICAM-1/CD54 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human ICAM-1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human ICAM-1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human ICAM-1 protein samples are stable below -20°C for 3 months.