Cat#:RPH-NP173;Product Name:Recombinant Human Growth Dfferentiation Factor 11 / GDF-11 / BMP-11 Protein;Synonym:Growth/differentiation factor 11,GDF-11,Bone morphogenetic protein 11,BMP-11;Description:Recombinant Human Growth differentiation factor 11 Protein is produced in Human Cells and the target gene encoding Asn299-Ser407 is expressed.;Source:Human Cells;AA Sequence:NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQAN PRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Growth Dfferentiation Factor 11/GDF-11/BMP-11 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Growth Dfferentiation Factor 11/GDF-11/BMP-11 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human GDF11 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human GDF11 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human GDF11 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;