Cat#:RPH-NP125;Product Name:Recombinant Human FGF R5 / FGFRL1 Protein;Synonym:Fibroblast Growth Factor Receptor-Like 1, FGF Receptor-Like Protein 1, FGF Homologous Factor Receptor, FGFR-Like Protein, Fibroblast Growth Factor Receptor 5, FGFR-5, FGFRL1, FGFR5, FHFR;Description:Recombinant Human FGFRL1 Protein is produced in Human Cells and the target gene encoding Ala25-Pro378 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:ARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWTKDGRTIHSGWSRFRVLPQGLKVKQV EREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSK MRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKY TCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRV EYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFR SAFLTVLPDPKPPGPPVASSSSATSLPWPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human FGF R5/FGFRL1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.;Stability:Recombinant Human FGF R5/FGFRL1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human FGFR5 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human FGFR5 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human FGFR5 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human FGF R5/FGFRL1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Stability:
Recombinant Human FGF R5/FGFRL1 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human FGFR5 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human FGFR5 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human FGFR5 protein samples are stable below -20°C for 3 months.