Cat#:RPH-NP130;Product Name:Recombinant Human Fibroblast Growth Factor 17 / FGF17 Protein;Synonym:Fibroblast Growth Factor 17, FGF-17, FGF17;Description:Recombinant Human Fibroblast Growth Factor 17 Protein is produced in E.coli and the target gene encoding Thr23-Thr216 is expressed.;Source:E. coli;AA Sequence:MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKL IVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFM AFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fibroblast Growth Factor 17/FGF17 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Fibroblast Growth Factor 17/FGF17 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human FGF17 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF17 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF17 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Fibroblast Growth Factor 17/FGF17 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Fibroblast Growth Factor 17/FGF17 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human FGF17 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF17 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF17 protein samples are stable below -20°C for 3 months.