Cat#:RPH-NP113;Product Name:Recombinant Human Ephrin B Receptor 1 / EphB1 Protein;Synonym:Ephrin Type-B Receptor 1, ELK, EPH Tyrosine Kinase 2, EPH-Kike Kinase 6, EK6, hEK6, Neuronally-Expressed EPH-Related Tyrosine Kinase, NET, Tyrosine-Protein Knase Receptor EPH-2, EPHB1, ELK, EPHT2, HEK6, NET;Description:Recombinant Human Ephrin B Receptor 1 Protein is produced in Human Cells and the target gene encoding Met18-Pro540 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:MEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGA HRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFS QVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTG AESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKA SQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEW HPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQ AINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYY EKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELRE QLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Ephrin B Receptor 1/EphB1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Ephrin B Receptor 1/EphB1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human EphB1 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human EphB1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human EphB1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;