Cat#:RPH-NP115;Product Name:Recombinant Human Ephrin-A1 / EFNA1 / LERK-1 Protein;Synonym:Ephrin-A1, EPH-Related Receptor Tyrosine Kinase Ligand 1, LERK-1, Immediate Early Response Protein B61, Tumor Necrosis Factor Alpha-Induced Protein 4, TNF Alpha-Induced Protein 4, EFNA1, EPLG1, LERK1, TNFAIP4;Description:Recombinant Human Ephrin-A1 Protein is produced in Human Cells and the target gene encoding Asp19-Ser182 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQ SKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVS GKITHSPQAHVNPQEKRLAADDPEVRVLHSIAHSVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Ephrin-A1/EFNA1/LERK-1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Ephrin-A1/EFNA1/LERK-1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human EFNA1 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human EFNA1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human EFNA1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Ephrin-A1 / EFNA1 / LERK-1 Protein
Online Inquiry
Cat#:
RPH-NP115
Product Name:
Recombinant Human Ephrin-A1 / EFNA1 / LERK-1 Protein
Synonym:
Ephrin-A1, EPH-Related Receptor Tyrosine Kinase Ligand 1, LERK-1, Immediate Early Response Protein B61, Tumor Necrosis Factor Alpha-Induced Protein 4, TNF Alpha-Induced Protein 4, EFNA1, EPLG1, LERK1, TNFAIP4
Description:
Recombinant Human Ephrin-A1 Protein is produced in Human Cells and the target gene encoding Asp19-Ser182 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Ephrin-A1/EFNA1/LERK-1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Ephrin-A1/EFNA1/LERK-1 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human EFNA1 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human EFNA1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human EFNA1 protein samples are stable below -20°C for 3 months.