Cat#:RPH-NP102;Product Name:Recombinant Human C-X-C Motif Chemokine 7 / CXCL7 / NAP2 Protein;Synonym:Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-Derived Growth Factor, LDGF, Macrophage-Derived Growth Factor, MDGFSmall-Inducible Cytokine B7, PPBP, CTAP3, CXCL7, SCYB7, TGB1, THBGB1;Description:Recombinant Human C-X-C Motif Chemokine 7 Protein is produced in Human Cells and the target gene encoding Ser35-Asp128 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:SSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLK DGRKICLDPDAPRIKKIVQKKLAGDESADVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-X-C Motif Chemokine 7/CXCL7/NAP2 Protein was lyophilized from a 0.2 μm filtered solution of 20mMHAc-Nac,150mM NaCl, pH 4.0.;Stability:Recombinant Human C-X-C Motif Chemokine 7/CXCL7/NAP2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CXCL7 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human CXCL7 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CXCL7 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;