Cat#:RPH-NP095;Product Name:Recombinant Human C-X-C Motif Chemokine 14 / CXCL14 Protein;Synonym:C-X-C Motif Chemokine 14, Chemokine BRAKm MIP-2G, Small-Inducible Cytokine B14, CXCL14, MIP2G, NJAC, SCYB14;Description:Recombinant Human C-X-C Motif Chemokine 14 Protein is produced in E.coli and the target gene encoding Ser35-Glu111 is expressed.;Source:E.coli;AA Sequence:SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWY NAWNEKRRVYEE;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is 1.0-10.0 ng/ml.;Formulation:Recombinant Human C-X-C Motif Chemokine 14/CXCL14 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.;Stability:Recombinant Human C-X-C Motif Chemokine 14/CXCL14 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CXCL14 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CXCL14 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CXCL14 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;