• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human CD40 Ligand / CD40L / TNFSF5 Protein Online Inquiry

  • Cat#:
  • RPH-NP075
  • Product Name:
  • Recombinant Human CD40 Ligand / CD40L / TNFSF5 Protein
  • Synonym:
  • CD40 Ligand, CD40-L, T-Cell Antigen Gp39, TNF-Related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40LG, CD40L, TNFSF5, TRAP
  • Description:
  • Recombinant Human TNFSF5 Protein is produced in E.coli and the target gene encoding Met113-Leu261 is expressed.
  • Source:
  • E.coli
  • AA Sequence:
  • MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTF CSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVT DPSQVSHGTGFTSFGLLKL
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Bioactivity:
  • ED50 is 5-10 ng/ml.
  • Formulation:
  • Recombinant Human CD40 Ligand/CD40L/TNFSF5 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, 0.1mM EDTA, pH 7.0.
  • Stability:
  • Recombinant Human CD40 Ligand/CD40L/TNFSF5 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human CD40 ligand protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD40 ligand protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD40 ligand protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human CD30 / TNFRSF8 / CD30L Receptor Protein I Advanced Biomart
  • Online Inquiry

    refresh