Cat#:RPH-NP075;Product Name:Recombinant Human CD40 Ligand / CD40L / TNFSF5 Protein;Synonym:CD40 Ligand, CD40-L, T-Cell Antigen Gp39, TNF-Related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40LG, CD40L, TNFSF5, TRAP;Description:Recombinant Human TNFSF5 Protein is produced in E.coli and the target gene encoding Met113-Leu261 is expressed.;Source:E.coli;AA Sequence:MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTF CSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVT DPSQVSHGTGFTSFGLLKL;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is 5-10 ng/ml.;Formulation:Recombinant Human CD40 Ligand/CD40L/TNFSF5 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, 0.1mM EDTA, pH 7.0.;Stability:Recombinant Human CD40 Ligand/CD40L/TNFSF5 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CD40 ligand protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD40 ligand protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD40 ligand protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
ED50 is 5-10 ng/ml.
Formulation:
Recombinant Human CD40 Ligand/CD40L/TNFSF5 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, 0.1mM EDTA, pH 7.0.
Stability:
Recombinant Human CD40 Ligand/CD40L/TNFSF5 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CD40 ligand protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD40 ligand protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD40 ligand protein samples are stable below -20°C for 3 months.