Cat#:RPH-NP073;Product Name:Recombinant Human CD3 ε / CD3E Protein;Synonym:T-Cell Surface Glycoprotein CD3 Epsilon Chain, T-Cell Surface Antigen T3/Leu-4 Epsilon Chain, CD3e, CD3E, T3E;Description:Recombinant Human CD3 epsilon Protein is produced in Human Cells and the target gene encoding Asp23-Asp126 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEF SELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human CD3 ε/CD3E Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human CD3 ε/CD3E Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CD3E protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD3E protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD3E protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human CD3 epsilon Protein is produced in Human Cells and the target gene encoding Asp23-Asp126 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human CD3 ε/CD3E Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Stability:
Recombinant Human CD3 ε/CD3E Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CD3E protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD3E protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD3E protein samples are stable below -20°C for 3 months.