Cat#:RPH-NP066;Product Name:Recombinant Human C-C Motif Chemokine 5 / CCL5 / RANTES Protein;Synonym:C-C Motif Chemokine 5, EoCP, Eosinophil Chemotactic Cytokine, SIS-Delta, Small-Inducible Cytokine A5, T Cell-Specific Protein P228, TCP228, T-Cell-Specific Protein RANTES, CCL5, D17S136E, SCYA5;Description:Recombinant Human C-C Motif Chemokine 5 Protein is produced in Human Cells and the target gene encoding Ser24-Ser91 is expressed with a Fc, His tag at the C-terminus.;Source:Human Cells;AA Sequence:SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSL EMSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL5 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL5 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL5 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;