Cat#:RPH-NP057;Product Name:Recombinant Human C-C Motif Chemokine 23 / CCL23 Protein;Synonym:C-C Motif Chemokine 23, CK-Beta-8, CKB-8, Macrophage Inflammatory Protein 3, MIP-3, Myeloid Progenitor Inhibitory Factor 1, MPIF-1, Small-Inducible Cytokine A23, CCL23, MIP3, MPIF1, SCYA23;Description:Recombinant Human C-C Motif Chemokine 23 Protein is produced in E.coli and the target gene encoding Arg22-Asn120 is expressed.;Source:E.coli;AA Sequence:MRVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKPGVIF LTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-C Motif Chemokine 23/CCL23 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.;Stability:Recombinant Human C-C Motif Chemokine 23/CCL23 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL23 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL23 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL23 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human C-C Motif Chemokine 23/CCL23 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
Stability:
Recombinant Human C-C Motif Chemokine 23/CCL23 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CCL23 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL23 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL23 protein samples are stable below -20°C for 3 months.