Cat#:RP-6003H;Product Name:Recombinant Human CCL17 / TARC Protein;Synonym:C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.;Description:Recombinant human CCL17 Protein expressed in E.coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa. The recombinant human TARC protein is purified using our unique chromatographic techniques.;Source:E.coli;AA Sequence:ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD AIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS.;Purity:Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:The recombinant human CCL17 protein was determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.;Formulation:The recombinant human CCL17 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.;Stability:Recombinant Human CCL17 Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized human CCL17 protein in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized recombinant human CCL17 / TARC protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution recombinant human TARC protein should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;References:Tumor-associated macrophage or chemokine ligand CCL17 positively regulates the tumorigenesis of hepatocellular carcinoma. Zhu F, et al. Med Oncol, 2016 Feb. PMID 26781124;
Recombinant human CCL17 Protein expressed in E.coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa. The recombinant human TARC protein is purified using our unique chromatographic techniques.
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity:
The recombinant human CCL17 protein was determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
Formulation:
The recombinant human CCL17 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.
Stability:
Recombinant Human CCL17 Proteins are stable for up to 1 year from date of receipt at -70℃
Reconstitution:
It is recommended to reconstitute the lyophilized human CCL17 protein in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Storage:
Lyophilized recombinant human CCL17 / TARC protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution recombinant human TARC protein should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
References:
Tumor-associated macrophage or chemokine ligand CCL17 positively regulates the tumorigenesis of hepatocellular carcinoma. Zhu F, et al. Med Oncol, 2016 Feb. PMID 26781124