Cat#:RPH-NP110;Product Name:Recombinant Human D-β-Hydroxybutyrate Dehydrogenase Mitochondrial / BDH1 Protein;Synonym:D-Beta-Hydroxybutyrate Dehydrogenase Mitochondrial, BDH, 3-Hydroxybutyrate Dehydrogenase, BDH;Description:Recombinant Human 3-Hydroxybutyrate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Arg343 is expressed with a His tag at the N-terminus.;Source:E. coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMLATRLSRPLSRLPGKTLSACDRENGARRPLLLGSTSFIPIGRRT YASAAEPVGSKAVLVTGCDSGFGFALAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTV QLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRM TKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGN FIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHA LTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human D-β-Hydroxybutyrate Dehydrogenase Mitochondrial/BDH1 Protein was supplied as a 0.2 μm filtered solution of 50mM Tris, 1mM DTT, pH 7.5.;Stability:Recombinant Human D-β-Hydroxybutyrate Dehydrogenase Mitochondrial/BDH1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store recombinant human BDH1 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human 3-Hydroxybutyrate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Arg343 is expressed with a His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human D-β-Hydroxybutyrate Dehydrogenase Mitochondrial/BDH1 Protein was supplied as a 0.2 μm filtered solution of 50mM Tris, 1mM DTT, pH 7.5.
Stability:
Recombinant Human D-β-Hydroxybutyrate Dehydrogenase Mitochondrial/BDH1 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store recombinant human BDH1 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.