Cat#:RPH-NP016;Product Name:Recombinant Human Aldehyde Dehydrogenase 1-A2 / ALDH1A2 Protein;Synonym:Aldehyde dehydrogenase family 1 member A2, Retinaldehyde-specific dehydrogenase type 2, RALDH(II), Retinal dehydrogenase 2, ALDH1A2, RALDH2;Description:Recombinant Human Aldehyde dehydrogenase 1-A2 Protein is produced in E.coli and the target gene encoding Met1-Ser518 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MNHKVHHHHHHMTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRV FPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAV LATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQII PWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAA IASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFF NQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGV AEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFG LVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTV TVKIPQKNS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Aldehyde Dehydrogenase 1-A2/ALDH1A2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mMNaCl, pH7.5,20% Glycerol.;Stability:Recombinant Human Aldehyde Dehydrogenase 1-A2/ALDH1A2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human ALDH1A2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Aldehyde Dehydrogenase 1-A2 / ALDH1A2 Protein
Online Inquiry
Cat#:
RPH-NP016
Product Name:
Recombinant Human Aldehyde Dehydrogenase 1-A2 / ALDH1A2 Protein
Synonym:
Aldehyde dehydrogenase family 1 member A2, Retinaldehyde-specific dehydrogenase type 2, RALDH(II), Retinal dehydrogenase 2, ALDH1A2, RALDH2
Description:
Recombinant Human Aldehyde dehydrogenase 1-A2 Protein is produced in E.coli and the target gene encoding Met1-Ser518 is expressed with a His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Aldehyde Dehydrogenase 1-A2/ALDH1A2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mMNaCl, pH7.5,20% Glycerol.
Stability:
Recombinant Human Aldehyde Dehydrogenase 1-A2/ALDH1A2 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human ALDH1A2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.