Cat#:RPH-NP010;Product Name:Recombinant Human Activin Receptor 2A / Activin RIIA / ACVR2A Protein;Synonym:Activin Receptor Type-2A, Activin Receptor Type IIA, ACTR-IIA, ACTRIIA, ACVR2A, ACVR2;Description:Recombinant Human Activin Receptor IIA Protein is produced in Human Cells and the target gene encoding Ala20-Pro134 is expressed with a Fc, His tag at the C-terminus.;Source:Human Cells;AA Sequence:AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDIN CYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPVDDIEGRMDEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Activin Receptor 2A/Activin RIIA/ACVR2A Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Activin Receptor 2A/Activin RIIA/ACVR2A Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human ACVR2A protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human ACVR2A protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human ACVR2A protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Activin Receptor IIA Protein is produced in Human Cells and the target gene encoding Ala20-Pro134 is expressed with a Fc, His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Activin Receptor 2A/Activin RIIA/ACVR2A Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Activin Receptor 2A/Activin RIIA/ACVR2A Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human ACVR2A protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human ACVR2A protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human ACVR2A protein samples are stable below -20°C for 3 months.