Cat#:RPH-NP007;Product Name:Recombinant Human 4-1BB / TNFRSF9 / CD137 Protein;Synonym:CD137, ILA, TNFRSF9, 4-1BB ligand receptor, CDw137, T-cell antigen 4-1BB homolog, T-cell antigen ILA;Description:Recombinant Human 4-1BB ligand receptor Protein is produced in Human Cells and the target gene encoding Leu24-Gln186 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDC TPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKE RDVVCGPSPADLSPGASSVTPPAPAREPGHSPQDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human 4-1BB/TNFRSF9/CD137 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.;Stability:Recombinant Human 4-1BB/TNFRSF9/CD137 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human 4-1BB protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human TNFRSF9 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human 4-1BB protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human 4-1BB ligand receptor Protein is produced in Human Cells and the target gene encoding Leu24-Gln186 is expressed with a Fc tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human 4-1BB/TNFRSF9/CD137 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Stability:
Recombinant Human 4-1BB/TNFRSF9/CD137 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human 4-1BB protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human TNFRSF9 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human 4-1BB protein samples are stable below -20°C for 3 months.