Cat#:RPH-NP336;Product Name:Recombinant Human RANKL / TRANCE / TNFSF11 Protein;Synonym:CD254, ODF, OPGL, RANK L, TNFSF11, CD254, Osteoclast differentiation factor, Receptor activator of nuclear factor kappa-B ligand, tumor necrosis factor ligand superfamily member 11;Description:Recombinant Human Receptor Activator of NF-kappa-B ligand Protein is produced in E.coli and the target gene encoding Ile140-Asp317 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVS LSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIK IPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKV RDID;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human RANKL/TRANCE/TNFSF11 Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.;Stability:Recombinant Human RANKL/TRANCE/TNFSF11 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human RANKL protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human RANKL protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human RANKL protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;