Cat#: | RPH-NP279 |
Product Name: | Recombinant Human LR3 Insulin-Like Growth Factor I / LR3 IGF1 Protein (MG) |
Synonym: | Insulin-Like Growth Factor I, IGF-I, Mechano Growth Factor, MGF, Somatomedin-C, IGF1, IBP1 |
Description: | Recombinant Human LR3-IGF-1 Protein is produced in E.coli and the target gene encoding Gly49-Ala118 is expressed. |
Source: | E.coli |
AA Sequence: | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSC DLRRLEMYCAPLKPAKSA |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin: | < 0.05 ng/µg (0.5 IEU/µg) as determined by LAL test. |
Bioactivity: | ED50 is greater than 200 ng/ml. |
Formulation: | Recombinant Human LR3 Insulin-Like Growth Factor I/LR3 IGF1 Protein (MG)was lyophilized from a 0.2 μm filtered solution of 300mM HAc-NaAc, pH 6.5. |
Stability: | Recombinant Human LR3 Insulin-Like Growth Factor I/LR3 IGF1 Protein (MG)is stable for up to 1 year from date of receipt at -70℃. |
Reconstitution: | Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 500mM Acetic Acid.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Usage: | For Lab Research Use Only |
Storage: | Lyophilized recombinant human LR3 IGF1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LR3 IGF1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human LR3 IGF1 protein samples are stable below -20°C for 3 months. |