Cat#:RPH-NP272;Product Name:Recombinant Human Leukocyte Ig-Like Receptor B1 / LILRB1 / ILT2 / CD85j Protein;Synonym:Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1, LIR-1, Leukocyte Immunoglobulin-Like Receptor 1, CD85 Antigen-Like Family Member J, Immunoglobulin-Like Transcript 2, ILT-2, Monocyte/Macrophage Immunoglobulin-Like Receptor 7, MIR-7, CD85j, LILRB1, ILT2, LIR1, MIR7;Description:Recombinant Human LILRB1 Protein is produced in Human Cells and the target gene encoding Gly24-His458 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSI TWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDG FILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELL VLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFT LGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQS QGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSD PLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Leukocyte Ig-Like Receptor B1/LILRB1/ILT2/CD85j Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human Leukocyte Ig-Like Receptor B1/LILRB1/ILT2/CD85j Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human LILRB1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LILRB1 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human LILRB1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;