Cat#:RPH-NP261;Product Name:Recombinant Human Isopentenyl Pyrophosphate Isomerase 2 / / IPPI2 / IDI2 Protein;Synonym:Isopentenyl-Diphosphate Delta-Isomerase 2, Isopentenyl Pyrophosphate Isomerase 2, IPP Isomerase 2, IPPI2, IDI2;Description:Recombinant Human IPP Isomerase 2 Protein is produced in E.coli and the target gene encoding Met1-Val227 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENI EKGLLHRAFSVVLFNTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQR RLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLS QEELWELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Isopentenyl Pyrophosphate Isomerase 2//IPPI2/IDI2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 0.1mM PMSF, pH 8.0.;Stability:Recombinant Human Isopentenyl Pyrophosphate Isomerase 2//IPPI2/IDI2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store recombiant human IPPI2 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;