Cat#: | RPH-NP197 |
Product Name: | Recombinant Human Interferon α-1 / 13 Protein |
Synonym: | Interferon alpha-1/13,IFN-alpha-1/13, Interferon alpha-D,LeIF D,IFNA1,IFNA13 |
Description: | Recombinant Human Interferon alpha-1 Protein is produced in Human Cells and the target gene encoding Cys24-Glu189 is expressed with a His tag at the C-terminus. |
Source: | Human Cells |
AA Sequence: | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIF NLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLY LTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEVDHHHHHH |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin: | < 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Formulation: | Recombinant Human Interferon α-1/13 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Stability: | Recombinant Human Interferon α-1/13 Protein is stable for up to 1 year from date of receipt at -70℃. |
Reconstitution: | Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Usage: | For Lab Research Use Only |
Storage: | Lyophilized Recombinant Human Interferon α-1/13 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted Human Interferon α-1/13 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted Human Interferon α-1/13 protein samples are stable below -20°C for 3 months. |