Cat#: | RPH-NP159 |
Product Name: | Recombinant Human Glial Cell Line-Derived Neurotrophic Factor / GDNF Protein |
Synonym: | Glial Cell Line-Derived Neurotrophic Factor, hGDNF, Astrocyte-Derived Trophic Factor, ATF, GDNF |
Description: | Recombinant Human GDNF Protein is produced in Human Cells and the target gene encoding Phe20-Ile211 is expressed with a Fc, His tag at the C-terminus. |
Source: | Human Cells |
AA Sequence: | FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMA VLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSC DAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIVDD IEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin: | < 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Formulation: | Recombinant Human Glial Cell Line-Derived Neurotrophic Factor/GDNF Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Stability: | Recombinant Human Glial Cell Line-Derived Neurotrophic Factor/GDNF Protein is stable for up to 1 year from date of receipt at -70℃. |
Reconstitution: | Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Usage: | For Lab Research Use Only |
Storage: | Lyophilized recombinant human GDNF protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human GDNF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human GDNF protein samples are stable below -20°C for 3 months. |