Cat#:RPH-NP127;Product Name:Recombinant Human Fibroblast Growth Factor 1 / FGF1 / FGFa Protein(Phe16-Asp155);Synonym:Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Endothelial Cell Growth Factor, ECGFHeparin-Binding Growth Factor 1, HBGF-1, FGF1, FGFA;Description:Recombinant Human Fibroblast growth factor 1 Protein is produced in E.coli and the target gene encoding Phe16-Asp155 is expressed.;Source:E. coli;AA Sequence:MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQY LAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKA ILFLPLPVSSD;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fibroblast Growth Factor 1/FGF1/FGFa Protein (Phe16-Asp155)was lyophilized from a 0.2 μm filtered solution of 20mM Tris, 400mM NaCl, 1mM DTT, pH 8.0, The ED50 for this effect is less than 2 ng/ml, measured in a cell proliferation assay using BALB/c 3T3 cells.;Stability:Recombinant Human Fibroblast Growth Factor 1/FGF1/FGFa Protein (Phe16-Asp155)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human FGF1 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF1 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;