Cat#:RPH-NP062;Product Name:Recombinant Human C-C Motif Chemokine 28 / CCL28 Protein;Synonym:C-C Motif Chemokine 28, Mucosae-Associated Epithelial Chemokine, MEC, Protein CCK1, Small-Inducible Cytokine A28, CCL28, SCYA28;Description:Recombinant Human C-C Motif Chemokine 28 Protein is produced in E.coli and the target gene encoding Ile20-Tyr127 is expressed.;Source:E.coli;AA Sequence:MSEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQ WMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-C Motif Chemokine 28/CCL28 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human C-C Motif Chemokine 28/CCL28 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL28 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL28 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL28 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;