Cat#:RPH-NP061;Product Name:Recombinant Human C-C Motif Chemokine 27 / CCL27 Protein;Synonym:C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-Cell-Attracting Chemokine, CTACK, Eskine, IL-11 R-Alpha-Locus Chemokine, Skinkine, Small-Inducible Cytokine A27, CCL27, ILC, SCYA27;Description:Recombinant Human C-C Motif Chemokine 27 Protein is produced in E.coli and the target gene encoding Phe25-Gly112 is expressed.;Source:E.coli;AA Sequence:FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWF EHQERKLHGTLPKLNFGMLRKMG;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-C Motif Chemokine 27/CCL27 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 500mM NaCl, pH 7.5.;Stability:Recombinant Human C-C Motif Chemokine 27/CCL27 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL27 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL27 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL27 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;