Cat#:RP-6066H;Product Name:Recombinant Human TGF b 1 Protein(GST Tag);Synonym:Transforming growth factor beta-1, TGF-beta-1, CED, DPD1, TGFB.;Description:The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag).;Source:E.coli;AA Sequence:KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRK PKVEQLSNMIVRSCKCS.;Purity:Greater than 80.0% as determined by SDS-PAGE.;Formulation:The protein solution (500µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced).;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;