Cat#:RP-4127H;Product Name:Recombinant Human IL37 Protein;Synonym:Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1, FIL1, FIL1(ZE;Description:Interleukin-37 Protein produced in E.coli is a single,?non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192)??and having a molecular mass of 18.6kDa. The?IL37 is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEK GSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYR AQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAE MSPSEVSD.;Purity:Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 µl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml.;Formulation:IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.;