Cat#:RP-4051H;Product Name:Recombinant Human IL23 Protein(His Tag);Synonym:Interleukin 23 alpha subunit p19, Interleukin-12 subunit beta p40, SGRF, IL23P19, IL-23-A, interleukin-six, G-CSF related factor, JKA3 induced upon T-cell activation, interleukin 12B (natural killer cell stimulatory factor 2 cytotoxic lymphocyte maturatio;Description:IL-23 Protein produced in HEK 293 cells is a heterodimer (IL23A co-transfected with IL12B), containing one polypeptide chain of IL23 protein (19.77kDa) fused with a C-terminal His tag and one polypeptide chain of IL12b-Flag (35.69kDa). The IL-23 is purified by proprietary chromatographic techniques.;Source:HEK 293 cells.;AA Sequence:IL23A-His: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCG DGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLS QLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP HHHHHHHH. IL12B-Flag: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGS;Purity:Greater than 90.0% as determined by analysis by SDS-PAGE.;Formulation:IL-23 His Tag protein is supplied in 50mM Tris pH 7.5, 130mM NaCl and 10% Glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;