Rabbit Anti-Endothelin A Receptor Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-13471P

• Product Name:
• Rabbit Anti-Endothelin A Receptor Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Endothelin A Receptor aa 378-427 (C terminal). The exact sequence is proprietary. (NP_001948.1). Sequence: NCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

• Species Reactivity:
• Human, African green monkey Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA, ICC/IF, IHC-P

• Storage Buffer:
• Preservative: 0.02% Sodium Azide Constituents: 50% Glycerol, PBS, 150mM Sodium chloride, pH 7.4

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid