• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Endothelin A Receptor Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-13471P
  • Product Name:
  • Rabbit Anti-Endothelin A Receptor Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human Endothelin A Receptor aa 378-427 (C terminal). The exact sequence is proprietary. (NP_001948.1). Sequence: NCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
  • Species Reactivity:
  • Human, African green monkey Predicted to work with: Mouse
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA, ICC/IF, IHC-P
  • Storage Buffer:
  • Preservative: 0.02% Sodium Azide Constituents: 50% Glycerol, PBS, 150mM Sodium chloride, pH 7.4
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Endothelin 3 Polyclonal Antibody-FPA-13470P
  • Online Inquiry

    refresh