Cat#:FPA-1067M;Product Name:Mouse Anti-AP2 alpha Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human AP2 alpha AA 1-100 (N terminal). (Purified from E.coli). Sequence: MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPN ADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQR ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow;Clone#:1Z19B4;Isotype:IgG1;Application:WB, Flow Cyt, ICC/IF;Positive control:Recombinant Human AP2 alpha protein (1-100aa); AP2 alpha (1-100aa)-hIgGFc transfected HEK293 cell lysate; HeLa cells.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;