Rabbit anti-Human Myogenin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12815P

• Product Name:
• Rabbit anti-Human Myogenin Polyclonal Antibody

• Synonym:
• MYF4; myf-4; bHLHc3; Myogenin

• Description:
• The antibody against Myogenin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Myogenin (NP_002470.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Myogenin (NP_002470.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Myogenin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS

• Gene ID:
• 4656

• Uniprot-ID:
• P15173

• Purification Method:
• Affinity purification

• Positive Samples:
• NIH/3T3, Rat heart