Cat#: | FPA-49902P |
Product Name: | Rabbit Anti-ZRANB3 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human ZRANB3 aa 640-689 (C terminal). The exact sequence is proprietary. from Isoform 3 Sequence: YCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTSKKVQTISDCEKQAL Database link: Q5FWF4-3 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 98% PBS, 2% Sucrose |