• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZRANB3 Polyclonal Antibody Online Inquiry

Cat#:FPA-49902P
Product Name:Rabbit Anti-ZRANB3 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human ZRANB3 aa 640-689 (C terminal). The exact sequence is proprietary. from Isoform 3 Sequence: YCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTSKKVQTISDCEKQAL Database link: Q5FWF4-3 Run BLAST with Run BLAST with
Species Reactivity: Human
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 98% PBS, 2% Sucrose

Online Inquiry

refresh