• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF75A Polyclonal Antibody Online Inquiry

Cat#:FPA-49849P
Product Name:Rabbit Anti-ZNF75A Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide corresponding to a region from N terminal aa 36-85 ( FVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVS ) of Human ZNF75A (NP_694573) Run BLAST with Run BLAST with
Species Reactivity: Human
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Preservative: None Constituents: 2% Sucrose, PBS

Online Inquiry

refresh