Cat#:FPA-49826P;Product Name:Rabbit Anti-ZNF7 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human ZNF7 aa 637-686 (C terminal). The exact sequence is proprietary. Sequence: EDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG Database link: P17097 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;
Synthetic peptide within Human ZNF7 aa 637-686 (C terminal). The exact sequence is proprietary. Sequence: EDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG Database link: P17097 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig