• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF7 Polyclonal Antibody Online Inquiry

Cat#:FPA-49826P
Product Name:Rabbit Anti-ZNF7 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human ZNF7 aa 637-686 (C terminal). The exact sequence is proprietary. Sequence: EDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG Database link: P17097 Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified

Online Inquiry

refresh